Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

     ⌊ Family UDP-N-acetyl-tunicamine-uracil synthase (TunB-like)

  ⌊ FunctionalDomain UDP-N-acetyl-tunicamine-uracil synthase (TunB) (ID 434568)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:22172915
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces chartreusis Taxon ID: 1969 497731628 WP_010045812.1 (RefSeq)
Streptomyces chartreusis NRRL 3882 Taxon ID: 1079985 341904718 AEL00521.1 (Genbank)
Streptomyces chartreusis NRRL 3882 Taxon ID: 1079985 334903193 AEH25658.1 (Genbank)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a E5KJ95 E5KJ95_STRCX (TrEMBL)

Sequence

Length of Enzyme (full-length): 338 | Length of Functional Domain: 338

1       10        20        30        40        50        60

MTGYTAPVRASLDVTYACDLRCIHCRTNTGEIPVHIRRKMLSIEQLQDIMLQLDRMGTFE
ITLTGGEPTIRKGFWQLLDVVPKLRHSTVTLITNAAAHTREQLDRIVDSGISSIRVSMDG
TRETFAAVRLMDVFDTVVENSIYLRDRVRSFKVLTTVMKTNQHNVFDLAHYLRAHGFRRQ
DLILVRAHGRGGRNRLLLTEEETMAVHRKVTEFKRDVPATDFDLNLNAPYLVPGEKLRPF
QDVVMFPYLVRDSSIAISATGDVTMSRLYSAAPLGNTKDAPVQEIWTQGQQQLVQEQEEF
TEERLREIFWDFATSDGPDGPPLTSLLDRQIFEGAEVR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
25 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
25 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
25 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

UDP-N-acetyl-tunicamine-uracil synthase

+
uridine
16704		 UDP-N-acetylgalactosamine-5,6-ene(2-)
85718		 UDP-N-acetyltunicamine-uracil(2-)
85719

EC: 4.-.-.- | IntEnz: 4.-.-.- | Kegg: 4.-.-.- | BioCyc: 4.-.-.- | BRENDA: 4.-.-.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:20 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 176 338
update domain start position 13 1
Oct. 15, 2016, 7:04 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update name TunB UDP-N-acetyl-tunicamine-uracil synthase (TunB)
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.