Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup methyltransferase (Class A)
⌊ Family adenosine C2 methyltransferase (RlmN-like)
⌊ FunctionalDomain RlmN-like sequence (ID 433417)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 445925358 | WP_000003213.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica Taxon ID: 59201 | 735754142 | KHP24430.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Oranienburg str. S-76 Taxon ID: 1323580 | 556546732 | ESP78728.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Saintpaul str. S-70 Taxon ID: 1321366 | 556543999 | ESP76417.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Eastbourne str. CFSAN001084 Taxon ID: 1194158 | 554402587 | ESJ32596.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gaminara str. ATCC BAA-711 Taxon ID: 984235 | 554292052 | ESH28289.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Chester str. ATCC 11997 Taxon ID: 941190 | 554277965 | ESH13728.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Minnesota str. ATCC 49284 Taxon ID: 1124956 | 554193475 | ESG32180.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Oranienburg str. 701 Taxon ID: 997334 | 554179272 | ESG18451.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Poona str. ATCC BAA-1673 Taxon ID: 1124962 | 554164758 | ESG04362.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Urbana str. ATCC 9261 Taxon ID: 1173938 | 554056512 | ESF01188.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 Taxon ID: 941188 | 366083097 | EHN47025.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gaminara str. A4-567 Taxon ID: 913071 | 353569453 | EHC34017.1 (Genbank) | URP |
| obsolete GIs = 418512885, 417351020 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1J4R6Z1 | A0A1J4R6Z1_SALET (TrEMBL) | |
| n/a | A0A0L3J760 | A0A0L3J760_SALET (TrEMBL) | |
| n/a | A0A1X2Y3I5 | A0A1X2Y3I5_SALET (TrEMBL) |
Length of Enzyme (full-length): 388 | Length of Functional Domain: 364
MSEQIVTPESSTPVVPNNETKINLLDLNRQQMREFFKNLGEKPFRADQVMKWMYHYCCDN
FDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRAT
LCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTGQRPITNVVMM
GMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHA
PNDTIRDEIVPINKKYNIETFLGAVRRYLEKSNANQGRVTIEYVMLDHVNDGTEHAHQLA
ELLKETPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDAACG
QLAGDVIDRTKRTLRKRMQGEVIDIKAI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



