Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

     ⌊ Family adenosyl-hopene transferase

  ⌊ FunctionalDomain adenosyl-hopene transferase (HpnH) (ID 429337)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Rhodopseudomonas palustris Taxon ID: 1076 499472633 WP_011159273.1 (RefSeq) URP
Rhodopseudomonas palustris TIE-1 Taxon ID: 395960 192286371 ACF02752.1 (Genbank) URP
Rhodopseudomonas palustris CGA009 Taxon ID: 258594 39650653 URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q6N3F9 Q6N3F9_RHOPA (TrEMBL)
n/a B3QHB8 B3QHB8_RHOPT (TrEMBL)

Sequence

Length of Enzyme (full-length): 386 | Length of Functional Domain: 336

1       10        20        30        40        50        60

MAIPFHKELVIGGYLLKQKLLGRKRYPLVLMLEPLFRCNLACAGCGKIDYPDAILNRRMT
AQECWDAAEECGAPMVAIPGGEPLIHKEIGEIVRGLVARKKFVSLCTNALLLEKKLHLFE
PSPYLFFSVHLDGLKEHHDKAVSQQGVFDRAVAAIKAAKAKGFTVNVNCTVFDGYAAEDI
AKFMDFTEELGVGVSISPGYAYERAPDQEHFLNRTKTKNLFREVFARGKGKKWSFMHSSM
FLDFLAGNQEFECTPWGMPARNIFGWQKPCYLLGEGYAKTFQELMETTDWDSYGTGKYEK
CADCMAHCGYEPTAAMASLNNPLKAAWVALRGIKTSGPMAPEIDMSKQRPAQYVFSEQVQ
KTLTQIRQDEAAEAKDKRQAERSTAA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
253 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
270 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
301 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
304 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA

Catalyzed Reaction

adenosyl-hopene transferase

+ 2 + 2 +
hop-22(29)-ene
4648		 S-adenosyl-L-methionine zwitterion
59789		 adenosylhopane
86403		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: 2.5.1.- | IntEnz: 2.5.1.- | Kegg: 2.5.1.- | BioCyc: 2.5.1.- | BRENDA: 2.5.1.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:15 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 310 374
update domain start position 5 1
Oct. 15, 2016, 6:51 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 374 336
update name Hopanoid biosynthesis associated radical SAM protein HpnH adenosyl-hopene transferase (HpnH)
EC number assigned by UniProtKB accession ID.