Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

     ⌊ Family adenosyl-hopene transferase

  ⌊ FunctionalDomain adenosyl-hopene transferase (ID 429314)

Superfamily Assignment Evidence Code(s) ISS PubMed:24888970
Family Assignment Evidence Code CFM PubMed:24888970
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 87882 493526245 WP_006480287.1 (RefSeq)
Burkholderia cenocepacia Taxon ID: 95486 815850150 KKI80990.1 (Genbank) URP
Burkholderia cepacia Taxon ID: 292 757913579 KIS52376.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A1B4DCK3 A0A1B4DCK3_9BURK (TrEMBL)
n/a A0A095EC78 A0A095EC78_BURCE (TrEMBL)
n/a A0A144V459 A0A144V459_9BURK (TrEMBL)
Show All

Sequence

Length of Enzyme (full-length): 386 | Length of Functional Domain: 338

1       10        20        30        40        50        60

MSIPLLQQVRVGAYIVRQHLSGNKRYPLALMLEPLFRCNLACNGCGKIDYPDPILNQRLS
VEECLQAVDECGAPVVSIAGGEPLLHKEMPEIVKGIMKRKKFVYLCTNALLMEKKMDDYQ
PSPYFVWSVHLDGDKDMHDHSVSQEGVYDKAVAAIKEAKRRGFRVNINCTLFNDAIPERV
AKFFDTLGPIGVDGITVSPGYAYERAPDQQHFLNRDKTKNLFREILKRGEGGKRWSFSQS
SLFLDFLAGNQTYKCTPWGNPARTVFGWQKPCYLVGEGYVKTFKELMETTEWDNYGVGNY
EKCADCMVHCGFEATAVMDTISNPLKALRVSRKGIKTDGPFAPDISIAKQRPAEYVFSRH
VEIKLEEIQRAGKGKLQKPAKSATAA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
38 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
45 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
255 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
272 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
303 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
306 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA

Catalyzed Reaction

adenosyl-hopene transferase

+ 2 + 2 +
hop-22(29)-ene
4648		 S-adenosyl-L-methionine zwitterion
59789		 adenosylhopane
86403		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: 2.5.1.- | IntEnz: 2.5.1.- | Kegg: 2.5.1.- | BioCyc: 2.5.1.- | BRENDA: 2.5.1.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:15 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 266 376
update domain start position 3 1
Oct. 15, 2016, 6:51 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 376 338
update family assignment evidence code IEA CFM
update name Hopanoid biosynthesis associated radical SAM protein HpnH adenosyl-hopene transferase
EC number assigned by UniProtKB accession ID.