Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup AviX12-like

     ⌊ Family avilamycin epimerase

  ⌊ FunctionalDomain avilamycin epimerase (AviX12) (ID 419741)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:16537546
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces viridochromogenes Taxon ID: 1938 740037124 WP_037886777.1 (RefSeq) URP
Streptomyces viridochromogenes Tue57 Taxon ID: 1160705 15077462 AAK83189.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q93KV6 Q93KV6_STRVR (TrEMBL)

Sequence

Length of Enzyme (full-length): 396 | Length of Functional Domain: 396

1       10        20        30        40        50        60

MTQPPPSPTMCVLPWIHLCASIDGVYGRCCVDDSMYHNELYESEAEPVFKLNADAVGCAP
NSRYAQDNPDEVRGLTEAFNSPNMRRTRLAMLAGERVSACDYCYHREDRGATSYRQSINE
RFADTVDFADLAERTAPDGSFEEFPFFLDIRFGNTCNLRCVMCAYPVSSGWGAKKRPKWS
SAVIDPYREDEELWATLRENAHLIRRLYFAGGEPFMQPGHFAMLDLLIETGNAENVDIVY
NSNLTVLPEKVFDRFPHFKSVGIGASCDGVGEVFERIRQPAKWDVFVANVRRAKTEVNLW
LQVAPQRLNLWGLRDLLLFAREEGLDADLANVVQWPDDLSVANLPDEEKRRATVELAELA
EWCDGLDWSKPAAHLRALSAFMNAADPSELIAEGGV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
156 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
163 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
156 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
163 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
156 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
163 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

avilamycin A epimerase

+ + +
avilamycin A precursor
85647		 S-adenosyl-L-methionine zwitterion
59789		 avilamycin A
85646		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: 5.1.3.- | IntEnz: 5.1.3.- | Kegg: 5.1.3.- | BioCyc: 5.1.3.- | BRENDA: 5.1.3.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:08 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 270 396
update domain start position 84 1
July 15, 2014, 6:19 a.m. update curation agent setDomainBoundaries.py holliday
Oct. 16, 2014, 6:47 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 6:31 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update name AviX12 protein avilamycin epimerase (AviX12)
EC number assigned by UniProtKB accession ID.