Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ BtrN-like SPASM domain containing

     ⌊ Family 2-deoxy-scyllo-inosamine dehydrogenase (BtrN-like)

  ⌊ FunctionalDomain Butirosin biosynthesis radical SAM-dependent enzyme (BtrN) (ID 419740)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code ISS
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 44249 497362269 WP_009676482.1 (RefSeq)
Paenibacillus sp. HGH0039 Taxon ID: 1078505 512151124 EPD93612.1 (Genbank) URP
Paenibacillus sp. HGF7 Taxon ID: 944559 333603733 EGL15137.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a F5LRC9 F5LRC9_9BACL (TrEMBL)

Sequence

Length of Enzyme (full-length): 250 | Length of Functional Domain: 250

1       10        20        30        40        50        60

MDKLFSMIEVEVNSQCNRTCWYCPNSVSQRKENGEMDPALYKTLMEQLSSLDFAGRISFH
FYGEPLLCKNLDLFVGMTSEYIPRARPIIYTNGDFLTEKRLQTLTELGIQKFIVTQHAGA
KHKFRGVYDQLAGADKEKVVYLDHSDLILSNRGGILDNIPQASKANMSCMVPSNLAVVTV
LGNVLPCFEDFNQKMVMGNISEHHISDIWNNDKFTSFRKMLKEGHRGKSDLCKNCNNVSV
QTEDQYDYVL
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
16 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
20 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
23 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 7/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
16 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
20 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
23 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
169 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
187 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
232 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
235 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 9/9 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
16 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24048029
20 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24048029
23 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ICS PubMed:24048029
152 Arg (R) side chain General acid/base proton relay -- reactant ICS PubMed:24048029
169 Cys (C) side chain SPASM Domain [Fe4S4] cluster binding metal ligand -- binding ICS PubMed:24048029
187 Cys (C) side chain SPASM Domain [Fe4S4] cluster binding metal ligand -- binding ICS PubMed:24048029
189 Glu (E) side chain Activates R152
Notes: CFM numbering 		activation -- spectator ICS PubMed:24048029
232 Cys (C) side chain SPASM Domain [Fe4S4] cluster binding metal ligand -- binding ICS PubMed:24048029
235 Cys (C) side chain SPASM Domain [Fe4S4] cluster binding metal ligand -- binding ICS PubMed:24048029

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4M7T Crystal Structure Of Btrn In Complex With Adomet And 2-Doia Btrn 3 1.56 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:08 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 237 250
update domain start position 7 1
Oct. 15, 2016, 6:31 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update subgroup SPASM/twitch domain containing BtrN-like SPASM domain containing
EC number assigned by UniProtKB accession ID.