Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup F420, menaquinone cofactor biosynthesis

  ⌊ menaquinone synthsis involved

     ⌊ Family cyclic dehypoxanthine futalosine synthase (mqnC-like)

  ⌊ FunctionalDomain cyclic dehypoxanthine futalosine synthase (ID 413486)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM IGS PubMed:23763543
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces coelicolor A3(2) Taxon ID: 100226 21222933 NP_628712.1 (RefSeq) PRP URP
Streptomyces coelicolor Taxon ID: 1902 499340018 WP_011029726.1 (RefSeq)
Streptomyces coelicolor A3(2) Taxon ID: 100226 206597143 PRP URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Cyclic dehypoxanthine futalosine synthase {ECO:0000255|HAMAP-Rule:MF_00992} Q9XAP2 MQNC_STRCO (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 399 | Length of Functional Domain: 362

1       10        20        30        40        50        60

MTEKADLQPILDRAAAGGRITPEEALDLYRDAPLHALGAAADAVRRRRYAGTEHIATYII
ERNINYTNVCVTACKFCAFYAAPKDTKKGWSRDLDDILRRCAETVELGGTQIMFQGGHHP
DYGVEYYEEHFAAIKKEFPQLVIHSLGASEVEHMARISKVSVEEAIRRIHAAGLDSFAGA
GAELLPERPRKAIAPLKESGERWLEIMEIAHGLGVESTSTMLMGTGETNAERIEHLRMIR
DVQDRTGGFRAFIPYTYQPENNHLKGRTQATLFEYLRMIAIARVFLDNVAHIQGSWLTTG
KEVGQLSLHYGADDLGSIMLEENVVSSAGAKHRSNRLEIIDLIRKAGRVPAQRATTYEHL
VVHDDPANDPVDERVVSHISSTAIEGGTAHPELKLLAPN
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
74 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
77 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
74 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
77 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
74 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
77 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

cyclic dehypoxanthinyl futalosine synthase

+ + + +
S-adenosyl-L-methionine zwitterion
59789		 dehypoxanthine futalosinate
58864		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844		 cyclic dehypoxanthinylfutalosinate(1-)
64270		 hydron
15378

EC: 1.21.98.1 | IntEnz: 1.21.98.1 | Kegg: 1.21.98.1 | BioCyc: 1.21.98.1 | BRENDA: 1.21.98.1

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:03 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 363 381
Oct. 15, 2016, 6:14 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 381 366
update family assignment evidence code CFM,IGS CFM IGS
update name Menaquinone biosynthetic enzyme (MqnC) cyclic dehypoxanthine futalosine synthase
update domain start position 1 5
update subgroup F420, menaquinone cofactor biosynthesis menaquinone synthsis involved
EC number assigned by UniProtKB accession ID.