Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

     ⌊ Family paromamine deoxygenase

  ⌊ FunctionalDomain paromamine deoxygenase (AprD4) (ID 413115)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:26879038
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces tenebrarius Taxon ID: 1933 85813548

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q2MFI7 Q2MFI7_STRSD (TrEMBL)

Sequence

Length of Enzyme (full-length): 457 | Length of Functional Domain: 457

1       10        20        30        40        50        60

MRRMRLGTVLLVSPKTSFGRDLQRTYAGGLGTVCKDEDFLLPPLDLMRLAGVLREDADDI
AIADEEVTGVVPSVEPGTTVICHVSLPSLLEDAERLATFRAQGARCYAYTSIRSPAQWRT
LFERGGCEGVLLPESISFARAALAGDHTVPGLVTPDSLLDPRHHQPAFGDLAAEPLPARD
LVDHTPYMFPPIARTGITSINGSFGCPYPCRFYCPYPLSEGRKIRTYPVERIVAEFRQCA
ELGITAAVFRDPVFSFHRDRTLELCQALKAADTGVPWWCETRIDRLDEEVVAALVDAGCV
GVEVGVESGDPDMQATAVRKRLNLDTVRKFHAVARKAGLKLVFLFLIGLPRETRMSIRRT
FDFILELGLADTEFNLSVITPYPGTELHQIAVDKGWIDGSQNAFTSHNAVMHTDELSIGD
LERASRFVDELHAVCKAGPAERAEFQARVHAWSTGDA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
214 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
214 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
214 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

paromamine deoxygenase

+ + + +
paromamine
7933		 S-adenosyl-L-methionine zwitterion
59789		 4'-oxolividamine
132423		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844		 water
15377

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:03 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 455 454
update domain start position 2 136
March 29, 2016, 6:35 a.m. update curation agent setDomainBoundaries.py holliday
Oct. 15, 2016, 8:20 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 454 457
update name uncharacterized Radical SAM superfamily sequence paromamine deoxygenase (AprD4)
update domain start position 136 1
EC number assigned by UniProtKB accession ID.