Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like

  ⌊ methyltransferase (class C)

     ⌊ Family 3-methyl-2-indolic acid methyltransferase (NocN/NosN like)

  ⌊ FunctionalDomain NocB (ID 396957)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code ISS PubMed:21107653
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Amycolatopsis fastidiosa Taxon ID: 1816 296933177 ADH93700.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a D7SA59 D7SA59_9PSEU (TrEMBL)

Sequence

Length of Enzyme (full-length): 391 | Length of Functional Domain: 391

1       10        20        30        40        50        60

MLMLYVHVPFCHSKCTFCDWVQAIPTKDLLRKPEDSVRKNYVRALVTEIETRGAQLRAAG
QVPYVVYWGGGTASSLDNAEAEAIWGALDSAFDLSTVAEATIECSPDTVDKAKLEFFRGL
GFNRVSSGVQSFDDARLRRLGRRHTAGEADRIVHHAREAGFDEVSIDIMSGFPDQELDEL
RATVEKAVSLPLTHLSLYSFRPTPGTFMRRKLAGTEKRAYLRKQQALFTEARRMIIDAGL
PEYASGYFGRVSPFAAMYFQLRADTAGFGSGAISLVDRQFLSHAKGKLHAYIQDPLAYDI
DVPAGQDRVLVSFLQAGLAMFDGVLREEWRVSTGTDLDEVLTRPSIAPLADFLRGRGLIE
DERGIRLDPRLAGLTLIELAFEMAMSQPESA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
11 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
11 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
11 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
18 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

3-methyl-2-indolic acid methyltransferase

+ 2 + + +
3-methyl-2-indolate
85502		 S-adenosyl-L-methionine zwitterion
59789		 3,4-dimethylindole-2-carboxylate
87160		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 2:46 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 318 391
May 11, 2015, 12:28 p.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.