Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup anaerobic coproporphyrinogen-III oxidase like

  ⌊ methyltransferase (class C)

     ⌊ Family 3-methyl-2-indolic acid methyltransferase (NocN/NosN like)

  ⌊ FunctionalDomain NosN (ID 396599)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:19678698
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces actuosus Taxon ID: 1885 238626064 ACR48343.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a C6FX53 C6FX53_STRAS (TrEMBL)

Sequence

Length of Enzyme (full-length): 395 | Length of Functional Domain: 395

1       10        20        30        40        50        60

MRQNLLMIYVHIPFCHSKCTFCDWVQAIPTKDLLRKPGDSVRQKYISALCAEIAERGAMH
RAAGDIPHVLYWGGGTASSLDEQETAAVMEALHSSFDMSTVAEATIECSPDTVDERKLAF
YRGLGFNRVSSGVQSFDDDRLRRLGRRHTAEQAGRIVHAARAAGFEDVSIDIMSGFPDQE
ADELDRTVDRALELPVNHLSLYSFRPTPGTFMRRRMDSSERRTYLRRQQALFTRARRAIE
GFGLSEYANGYFGKVSPFASMYFQHRADTVGLGSGAISLVDQRFKSHQKGLLHSYVDDPL
AFDIDVPAGQDRVLVSLLQAGLAMFDGIPREDWRQRTGTDLAEVLLRPTVAPLADFLRGR
GLVEDDHGIRLPRDIAGLTLIELAFEMAMSQPELV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

nosiheptide methyltransferase

+ 2 + + +
3-methylindolyl precursor of nosiheptide
85713		 S-adenosyl-L-methionine zwitterion
59789		 3,4-dimethylindolyl precursor of nosiheptide
85714		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844		 S-adenosyl-L-homocysteine zwitterion
57856

EC: 2.1.1.- | IntEnz: 2.1.1.- | Kegg: 2.1.1.- | BioCyc: 2.1.1.- | BRENDA: 2.1.1.- |

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 5:51 a.m. update curation agent holliday setDomainBoundaries.py
Aug. 14, 2015, 12:09 p.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family - 3-methyl-2-indolic acid methyltransferase (NocN/NosN like)
EC number assigned by UniProtKB accession ID.