Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

     ⌊ Family neomycin C-like epimerase

  ⌊ FunctionalDomain neomycin C epimerase (NeoN) (ID 395103)

Superfamily Assignment Evidence Code(s) ISS PubMed:25230155
Family Assignment Evidence Code CFM PubMed:25230155
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Streptomyces sp. NRRL WC-3719 Taxon ID: 1463932 665535173 WP_031132490.1 (RefSeq)
Streptomyces fradiae Taxon ID: 1906 85813573 URP
Streptomyces fradiae Taxon ID: 1906 75504511 URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Neomycin C epimerase {ECO:0000305|PubMed:25230155} Q53U14 NEOEP_STRFR (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 299 | Length of Functional Domain: 299

1       10        20        30        40        50        60

MTTDIVWPPPVRQVRAYRNIVVDGACNIRCTYCEVKKTKVDQPATIRSLDRIFAEYEPDA
VLFRVESDGEITLYPKIVDHLQKRAAEGYRVEVLSNGTKLPRALEGRPDLLWVFSVDGHT
EAMNAKRGLKQPQIDRILDAAVELGAELQTVYWGQPVEEVNAYIDLLESRGYRGLLHFMP
LLAFKGRPLTVNLRYQDLHPADFLAPPEYFRRWNHIFETGRRDAVCDQITNGYNYQVSGD
EIRMVKCDCYSVPKHLVHGFGPIREFDDWPCGTCIANQEFNNSRERMRVPQGRIPLPLV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
26 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25230155
30 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25230155
33 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25230155
226 Cys (C) side chain Binds SPASM [4Fe-4S] cluster metal ligand -- binding ISS PubMed:25230155
247 Cys (C) side chain Binds SPASM [4Fe-4S] cluster metal ligand -- binding ISS PubMed:25230155
271 Cys (C) side chain Binds SPASM [4Fe-4S] cluster metal ligand -- binding ISS PubMed:25230155
274 Cys (C) side chain Binds SPASM [4Fe-4S] cluster metal ligand -- binding ISS PubMed:25230155

Catalyzed Reaction

neomycin C epimerase

+ + +
neomycin C
53634		 S-adenosyl-L-methionine zwitterion
59789		 framycetin
7508		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:38 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 299 296
update domain start position 1 5
Oct. 16, 2014, 5:48 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update domain end position 296 299
update name uncharacterized Radical SAM superfamily sequence neomycin C epimerase (NeoN)
update domain start position 5 1
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.