Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

     ⌊ Family anaerobic magnesium-protoporphyrin-IX monomethyl ester cyclase

  ⌊ FunctionalDomain Magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase sequence (ID 391980)

Superfamily Assignment Evidence Code(s) FSM PubMed:10841582
Family Assignment Evidence Code CFM PubMed:10841582 PubMed:2203738
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Rhodobacter capsulatus Taxon ID: 1061 502831437 WP_013066413.1 (RefSeq) URP
Rhodobacter capsulatus Y262 Taxon ID: 1415161 564974111 ETE54910.1 (Genbank) URP
Rhodobacter capsulatus B6 Taxon ID: 1415162 564886154 ETD87626.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase {ECO:0000303|PubMed:10841582} P26168 BCHE_RHOCB (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 575 | Length of Functional Domain: 575

1       10        20        30        40        50        60

MRILFVHPNYHSGGAEIAGNWPPSWVPYLAGHLKKAGFDDIHFIDAMTLNVSHDELRKKF
AELQPDLIGVTSITPSIYEAEETLKIAKEVVPNAVRVLGGVHATFMFRQVLSEAPWVDAI
VRGEGEEIMVELAKCVSEGRWPEDRASIKGLAFHDGTEIVATQAAPTVKDIDSLKPDWSL
IDWKHYIYIPLGVRVAIPNMARGCPFTCSFCSQWKFWRDYRVRSPKAVVDEIEDLVNNYD
VGFFILADEEPTINKKKFVEFCQEMIDRGLNHKVKWGINTRVTDIYRDRDLLKFYREAGL
VHISLGTEAAAQLKLDLFNKETTVAENKEAIRLLREADIFTEAQFIVGLDNETKETLEET
FQMAWDWQPDLANWSMYTPWPFTPLFQELRDQVEVFDFSKYNFVTPIMKPKALTRGELLD
GVMKNYRRFYMRKALFHYPWRGTGFRRRYLLGCLKAFLKAGVGRTFYDLGKAGYWGPQTK
DTVDFHFDETRKIAEAQVADWEAAADRSRKHKERQEALRAQMKDRAADRNTANFVMPADA
EDEFDLSAETHEARSAEHAAMACGGGKDQMVDAAE
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
204 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
208 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
211 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
204 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
208 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
211 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
204 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
208 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
211 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

anaerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase

+ 3 + + 3 + 3
magnesium protoporphyrin 13-monomethyl ester(1-)
60491		 S-adenosyl-L-methionine zwitterion
59789		 water
15377		 2,4-divinyl protochlorophyllide a(1-)
77667		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: 1.14.13.- | IntEnz: 1.14.13.- | Kegg: 1.14.13.- | BioCyc: 1.14.13.- | BRENDA: 1.14.13.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:36 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 379 575
update domain start position 79 1
July 15, 2014, 5:32 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code ISS CFM
update superfamily assignment evidence code ISS FSM
Oct. 16, 2014, 5:42 a.m. update curation agent holliday setDomainBoundaries.py
May 11, 2015, 12:09 p.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.