Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

     ⌊ Family hopanetetrol cyclitol ether synthase

  ⌊ FunctionalDomain bacteriohopanetetrol cyclitol ether synthase (HpnJ) (ID 391978)

Superfamily Assignment Evidence Code(s) ISS PubMed:24888970
Family Assignment Evidence Code CFM PubMed:24888970
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 87882 493529710 WP_006483725.1 (RefSeq)
Burkholderia cenocepacia Taxon ID: 95486 815848850 KKI79691.1 (Genbank) URP
Burkholderia cepacia Taxon ID: 292 757909262 KIS48062.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A107KYE2 A0A107KYE2_9BURK (TrEMBL)
n/a A0A095DNL6 A0A095DNL6_BURCE (TrEMBL)
n/a B4ECL3 B4ECL3_BURCJ (TrEMBL)

Sequence

Length of Enzyme (full-length): 473 | Length of Functional Domain: 473

1       10        20        30        40        50        60

MKTLFLQAPSYDGFDGGAGSRYQAKREIRSFWYPTWLAQPAALVPGSRVVDAPADGLSVE
ETLKIANDYDLVIIHTSTPSFPTDAMFAQDLKKMKPSMLVGMVGAKVMVDPHNSLTASEA
IDFVCREEFDFTCKELAEGKPFAEIKGLSWRAKDGSIEHNEARPILENMDELPFVAPVYK
RDLKIDNYFIGYLNYPYVSIYTGRGCKSRCTFCLWPQTVSGHRYRTRSVENVLAEAKWIR
DNMPEVKELMFDDDTFTDDLPRAEAIAIGLGKLGITWSCNAKANVPYKTLKVMKENGLRL
LLVGFESGDDQILVNIKKGVRTDFARRFSADCKKLGIKIHGTFILGLPGETQETIKKTIE
YAKEINPHTIQVSLAAPYPGTTLYKQAVENGWMEENKTINLVSKEGVQLAAIGYAHLSRD
EIYHHLEQFYRQFYFRPSKIWEIVREMLTSWDMMKRRLREGVEFFRFLRAHEA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
210 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
213 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

bacteriohopanetetrol cyclitol ether synthase

+ + +
bacteriohopanetetrol glucosamine
132143		 S-adenosyl-L-methionine zwitterion
59789		 bacteriohopanetetrol cyclital ether
132144		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:36 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 387 473
update domain start position 163 1
Oct. 15, 2016, 5:27 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family assignment evidence code IEA CFM
update name Hopanoid biosynthesis protein bacteriohopanetetrol cyclitol ether synthase (HpnJ)
EC number assigned by UniProtKB accession ID.