Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family hopanoid C3-methyltransferase (HpnR-like)

  ⌊ FunctionalDomain hopanoid C-3 methylase (HpnR) (ID 391653)

Superfamily Assignment Evidence Code(s) ISS PubMed:22826256
Family Assignment Evidence Code CFM PubMed:22826256
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Methylococcus capsulatus Taxon ID: 414 499262528 WP_010960068.1 (RefSeq)
Methylococcus capsulatus str. Bath Taxon ID: 243233 53758817 AAU93108.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
Hopanoid C-3 methylase {ECO:0000305} Q60AV6 HPNR_METCA (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 515 | Length of Functional Domain: 514

1       10        20        30        40        50        60

MKVFCVHPSPLMYTKVFLRLEPLGLELVAESLRRAGHDIRLMDLQVESHADFLRELDTWR
PDVVCFSLNYLANVPEVIDLAKTAKSRLPECFTFVGGHSASFVAKDLLDHGEGLLDCVLR
GEGEAGAPKLLETLARRGNIDEVPGVVSLTGEGPPPGFTDNLDEHLPARDLLKYRRKYFL
GTLDPCASIEFSRGCPWDCSFCSAWTFYGRSYRVMSTERIMEDLRRIKEPGIFIVDDVAF
IQAQHGMEIGEAIAREGIRKQYYLETRGDVLLRNKEVFKLWKKLGMEYMFLGVEAIDAEG
LQKFRKRVSLGKNFEALEFARSLGITVAINLIADPDWDRERFEVIRQWCMEIPEIVNISV
NTPYPGTESWHTESRQLTTRDYRLFDIQHAVLPTRLPLPEFYGELVKTQQVLYKKHMGWA
AARDTLKILGGHLLRGQTNFLRSLWKFNSVFNPELQLADHRQPVKYPMTLPPAPTEQKIE
AKTLYVHRSQGRKSRALDDATEKFVDEGRMGAATG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
199 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
202 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
199 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
202 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
195 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
199 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
202 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reactions

aminobacteriohopanepentol C3-methyltransferase

+ 2 + + +
35-aminobacteriohopane-30,31,32,33,34-pentol
87085		 S-adenosyl-L-methionine zwitterion
59789		 35-amino-3-methylbacteriohopane-30,31,32,33,34-pentol
87086		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

aminobacteriohopanetetrol C3-methyltransferase

+ 2 + + +
35-aminobacteriohopane-31,32,33,34-tetrol
87087		 S-adenosyl-L-methionine zwitterion
59789		 35-amino-3-methylbacteriohopane-31,32,33,34-tetrol
87088		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: 2.1.1.- | IntEnz: 2.1.1.- | Kegg: 2.1.1.- | BioCyc: 2.1.1.- | BRENDA: 2.1.1.- |

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 5:40 a.m. update curation agent holliday setDomainBoundaries.py
Aug. 14, 2015, 11:56 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code IEA CFM
update family carbapenem intermediate methyltransferase (ThnL-like) hopanoid C3-methyltransferase (HpnR-like)
update name ThnL Sequence hopanoid C-3 methylase (HpnR)
Aug. 14, 2015, 11:56 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 462 514
EC number assigned by UniProtKB accession ID.