Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup B12-binding domain containing

  ⌊ methyltransferase (Class B)

     ⌊ Family bacteriochlorophyll C8 methyltransferase

  ⌊ FunctionalDomain Bacteriochlorophyll c8 methyltransferase (ID 391322)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:19297239
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Chlorobium tepidum TLS Taxon ID: 194439 21674591 NP_662656.1 (RefSeq) URP
Chlorobaculum tepidum Taxon ID: 1097 499235897 WP_010933437.1 (RefSeq)
Chlorobium tepidum TLS Taxon ID: 194439 21647789 AAM72998.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q8KBK9 Q8KBK9_CHLTE (TrEMBL)

Sequence

Length of Enzyme (full-length): 451 | Length of Functional Domain: 446

1       10        20        30        40        50        60

MDDDSNQKPLFHMALGVLTSLTPPQHHIELVDEHFHDKINYDGDYDMVGITSRTIEATRA
YEIADEFRKRGKTVVLGGLHISFNPEEAAAHADCIVVGEADNLWTTLLDDVANNRLKERY
DSKDFPPVKAITPLDYARIAKASKRTKVDGTKSIPIYVTRGCPFNCSFCVTPNFTGKQYR
VQDPKLLKHQIEEAKKYFFKANGKNSKPWFMLTDENLGINKKKLWESLDLLKECDITFSV
FLSINFLEDPTTVKKLVDAGCNFVLAGLESIKQSTLEAYNKGHVNSAEKYSKIIEDCRKA
GLNIQGNFLFNPAIDTFEDIDELVQFVKKNHIFMPIFQIITPYPGTQMYHEYRESGLITI
EDWEKYNALHLVIKSDRYEPLLFQYKVLKSYVEVYTWKEILLRTLYNPRKLINLVTSIAF
KKHLAAQLKAFERNHKMNPAMLSGVKPVMNG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
162 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
166 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
169 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
162 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
166 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
169 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
162 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
166 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
169 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA

Catalyzed Reaction

bacteriochlorophyll C8 methyltransferase

2 + + + +
S-adenosyl-L-methionine zwitterion
59789		 Bacteriochlorophyll d
81553		 Bacteriochlorophyll d
81553		 S-adenosyl-L-homocysteine zwitterion
57856		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:35 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 448 446
update domain start position 2 1
EC number assigned by UniProtKB accession ID.