Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C2.A: Pyridoxal Phosphate Phosphatase Like

  ⌊ FunctionalDomain C2.A: Pyridoxal Phosphate Phosphatase Like (ID 38294)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onFeb. 13, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Homo sapiens Taxon ID: 9606 39644873 AAH09756.2 (Genbank) PRP URP

Uniprot

Protein NameAccessionEC Number Identifier
Pyridoxal phosphate phosphatase Q96GD0 PLPP_HUMAN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 176 | Length of Functional Domain: 175

1       10        20        30        40        50        60

ELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDP
WHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDPARTLMVGDRL
ETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVPHYYVESIADLTEGLE
D
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 3/5 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
93 Lys (K) side chain Orients Asp nucleophile steric role -- spectator ICS PubMed:16430214
118 Asp (D) side chain Mg2+ ligand metal ligand -- binding ICS PubMed:16430214
123 Asp (D) side chain Mg2+ ligand (via water) metal ligand -- binding ICS PubMed:16430214

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
2CFT Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase With Its Substrate Pyridoxal Phosphate Phosphatase 10 1.8 Calcium Ion • Pyridoxal-5'-Phosphate CSA • PDB • PDBSum
2CFS Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Pyridoxal Phosphate Phosphatase 10 2.4 Magnesium Ion CSA • PDB • PDBSum
2CFR Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Pyridoxal Phosphate Phosphatase 9 2.4 Selenomethionine • Magnesium Ion CSA • PDB • PDBSum
2OYC Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Pyridoxal Phosphate Phosphatase 9 1.72 Selenomethionine
(2 more ⇓)
CSA • PDB • PDBSum
2P27 Crystal Structure Of Human Pyridoxal Phosphate Phosphatase With Mg2+ At 1.9 A Resolution Pyridoxal Phosphate Phosphatase 9 1.9 Selenomethionine • Magnesium Ion CSA • PDB • PDBSum
2P69 Crystal Structure Of Human Pyridoxal Phosphate Phosphatase With Plp Pyridoxal Phosphate Phosphatase 9 2.25 Selenomethionine
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
April 30, 2014, 6:10 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 176 175
EC number assigned by UniProtKB accession ID.