Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ dehydrogenase like

     ⌊ Family anaerobic Ser-type sulfatase-maturating enzyme

  ⌊ FunctionalDomain Anaerobic sulfatase-maturating enzyme (ID 381258)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:18408004
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Klebsiella pneumoniae Taxon ID: 573 62286584 URP
Klebsiella pneumoniae Taxon ID: 573 4586202 URP

Uniprot

Protein NameAccessionEC Number Identifier
Anaerobic sulfatase-maturating enzyme Q9X758 1.1.99.- ANSME_KLEPN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 395 | Length of Functional Domain: 376

1       10        20        30        40        50        60

MLNIAALRQQQIPLAAEPRSPVPFHILMKPIGPACNLACRYCYYPQDETPVNKMDDARLE
QFIRRYIAAQPAGAREINFVWQGGEPLLAGLSFYKKALALQARYAPDGVTISNSLQTNGT
LINDAWCRLFREHGFIIGLGLEGNEALQDYHRPDKRGRSTWSAALRGIDLLHQHQVDFNL
LVVVHNEMAAHAAAIYVRLVSLGARYLQFQPLMSEGAALREGYQLSADNWGRFMVGIWRQ
WRKRCDRGRVFVINIEQAWAQYFTHTSGSCVHSARCGSNLVMESDGQLYACDHLINTEHR
LGRLDEQTLAAAVDASVQLPFGQQKSLRRECQTCSVKMVCQGGCPAHLNAAGNNRLCGGY
YRFFSDILAPLRPFSRDLNGLKAWRAAFVGTAHTA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
334 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
340 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
357 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 10/10 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
35 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
39 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
42 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
270 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
276 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
291 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
331 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
334 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
340 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
344 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS

Catalyzed Reaction

Ser-type sulfatase maturase

+ + +
L-serine residue
29999		 S-adenosyl-L-methionine zwitterion
59789		 3-oxoalanine residue
85621		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: 1.1.99.- | IntEnz: 1.1.99.- | Kegg: 1.1.99.- | BioCyc: 1.1.99.- | BRENDA: 1.1.99.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:30 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 395 389
update domain start position 1 15
Oct. 15, 2016, 5:10 a.m. update domain start position 15 14
EC number assigned by UniProtKB accession ID.