Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 38024)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia albertii Taxon ID: 208962 | 445952143 | WP_000029998.1 (RefSeq) | URP |
| Escherichia albertii TW07627 Taxon ID: 502347 | 170124654 | EDS93585.1 (Genbank) | URP |
| Escherichia albertii NBRC 107761 Taxon ID: 1115511 | 689835984 | URP | |
| obsolete GI = 170765508 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | B1EFJ1 | B1EFJ1_ESCAT (TrEMBL) |
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASIETCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFNDLLKKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAIADAHPLLIPRADYVTYIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



