Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 37844)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | Feb. 13, 2017 |
References to Other Databases
Genbank: obsolete GIs = 213855446, 446330538
Length of Enzyme (full-length): 135 | Length of Functional Domain: 129
FNVRDGYGIRCALTSNIEVAIITGRKAKLVEDRCATLGIVHLYQGQSNKLIAFSDLLEKL
AIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTHIAGGRGAVREVCDLL
LLAQGKLDEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.