Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup lipoyl synthase like

     ⌊ Family lipoyl synthase

  ⌊ FunctionalDomain Lipoyl synthase sequence (ID 376759)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code ISS
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Thermosynechococcus elongatus BP-1 Taxon ID: 197221 22298117 NP_681364.1 (RefSeq) URP
Thermosynechococcus elongatus Taxon ID: 146786 499368844 WP_011056422.1 (RefSeq)
Synechococcus elongatus Taxon ID: 32046 296521672
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Lipoyl synthase 2 {ECO:0000255|HAMAP-Rule:MF_00206} Q8DLC2 LIPA2_THEEB (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 290 | Length of Functional Domain: 288

1       10        20        30        40        50        60

MALSRPLPSWLRKPLGKASEISTVQRLVRQYGIHTICEEGRCPNRGECYGQKTATFLLLG
PTCTRACAFCQVEKGHAPAAVDPEEPTKIAAAVATLGLRYVVLTSVARDDLPDQGAGQFV
ATMAAIRQRCPGTEIEVLSPDFRMDRGRLSQRDCIAQIVAAQPACYNHNLETVRRLQGPV
RRGATYESSLRVLATVKELNPDIPTKSGLMLGLGETEAEIIETLKDLRRVGCDRLTLGQY
LPPSLSHLPVVKYWTPEEFNTLGNIARELGFSHVRSGPLVRSSYHAAEGG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
63 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
67 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
37 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
42 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
48 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
63 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861
67 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
37 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
42 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
48 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding IDA PubMed:15362861
63 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861
67 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861
70 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IDA PubMed:15362861

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4U0P The Crystal Structure Of Lipoyl Synthase In Complex With S-Adenosyl Homocysteine Lipoyl Synthase 2 1 1.62 Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
4U0O Crystal Structure Of Thermosynechococcus Elongatus Lipoyl Synthase 2 Complexed With Mta And Dtt Lipoyl Synthase 2 1 1.6 Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:27 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 290 289
update domain start position 1 2
EC number assigned by UniProtKB accession ID.