Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 37027)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 486160537 | WP_001524154.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 Taxon ID: 439847 | 205323214 | EDZ11053.1 (Genbank) | URP |
| obsolete GI = 167552034 | |||
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASLATCYGPVSTHVMTKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSNIEVAIITGRKAKLVEDRCATLGIVHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLVDWPVMEKVGLSVAVADAHPLLIPRADYVTHIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



