Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 37006)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank: obsolete GIs = 213586481, 487695516
Length of Enzyme (full-length): 152 | Length of Functional Domain: 132
MSKAGASLATCYGPVSTHVMTKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSNIEVAIITGRKAKLVEDRCATLGIVHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAVADAHPLLIPR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



