Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type I

    ⌊ Subgroup Terpene Cyclase Like 1 C Terminal Domain

  ⌊ Terpene Cyclase Like 1 C Terminal Domain - Enzymatic

  ⌊ FunctionalDomain Abietadiene Synthase, C Terminal Domain (ID 3697)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 24, 2017

Related Enzyme Functional Domain(s)

Abietadiene Synthase, N Terminal Domain

References to Other Databases

Genbank

SpeciesGIAccessionProteome
n/a 757015739 AJN59783.1 (Genbank)
n/a 389728649 AFK97048.1 (Genbank)
Abies grandis Taxon ID: 46611 15080737 AAK83563.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
Bifunctional abietadiene synthase, chloroplastic Q38710 TPSDV_ABIGR (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 853 | Length of Functional Domain: 327

1       10        20        30        40        50        60

AHHLTANTQSIPHFSTTLNAGSSASKRRSLYLRWGKGSNKIIACVGEGGATSVPYQSAEK
NDSLSSSTLVKREFPPGFWKDDLIDSLTSSHKVAASDEKRIETLISEIKNMFRCMGYGET
NPSAYDTAWVARIPAVDGSDNPHFPETVEWILQNQLKDGSWGEGFYFLAYDRILATLACI
ITLTLWRTGETQVQKGIESFRTQAGKMEDEADSHRPSGFEIVFPAMLKEAKILGLDLPYD
LPFLKQIIEKREAKLKRIPTDVLYALPTTLLYSLEGLQEIVEWEKIMKLQSKDGSFLSSP
ASTAAVFMRTGNKKCLDFLNFVLKKFGNHVPCHYPLDLFERLWAVDTVERLGIDRHFKEE
IKEALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYNVSSDVLKTFRDENGEF
FCFLGQTQRGVTDMLNVNRCSHVSFPGETIMEEAKLCTERYLRNALENVDAFDKWAFKKN
IRGEVEYALKYPWHKSMPRLEARSYIENYGPDDVWLGKTVYMMPYISNEKYLELAKLDFN
KLQSIHQTELQDLRRWWKSSGFTELNFTRERVTEIYFSPASFIFEPEFSKCREVYTKTSN
FTVILDDLYDAHGSLDDLKLFTESVKRWDLSLVDQMPKQMKICFVGFYNTFNDIAKEGRE
RQGRDVLGYIQNVWKVQLEAYTKEAEWSEAKYVPSFNEYIENASVSIALGTVVLISALFT
GEVLTDEVLSKIDRESRFLQLMGLTGRLVNDTKTYQAERGQGEVASAIQCYMKDHPKISE
EEALQHVYSVMENALEELNREFVNNKIPDIYKRLVFETARIMQLFYMQGDGLTLSHDMEI
KEHVKNCLFQPVA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
606 Asp (D) side chain None --
610 Asp (D) side chain None --
750 Asn (N) side chain None --
Subgroup CAR This EFD conserves 8/8 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
569 Arg (R) side chain Hydrogen bonds to PPi electrostatic stabiliser -- spectator ICS PubMed:12432096
606 Asp (D) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
607 Asp (D) side chain None -- ISS PubMed:16895335
610 Asp (D) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
617 Asp (D) side chain Electrostatic interaction with R near N-terminus assists in active site closure electrostatic stabiliser -- spectator ICS PubMed:17372193
747 Arg (R) side chain Hydrogen bonds to PPi electrostatic stabiliser -- spectator ICS PubMed:12432096
750 Asn (N) side chain Metal ligand metal ligand -- binding ICS PubMed:12432096
751 Asp (D) side chain None -- ISS PubMed:16895335

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3S9V Abietadiene Synthase From Abies Grandis Abietadiene Synthase, Chloroplastic 10 2.3 CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 11:58 a.m. update curation agent holliday setDomainBoundaries.py
update domain start position 543 49
May 31, 2014, 11:31 a.m. update domain start position 49 527
EC number assigned by UniProtKB accession ID.