Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ FunctionalDomain C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like (ID 36613)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 620 | 445952154 | WP_000030009.1 (RefSeq) | |
| Shigella boydii 965-58 Taxon ID: 766138 | 391267338 | EIQ26275.1 (Genbank) | URP |
| Shigella dysenteriae 155-74 Taxon ID: 766142 | 332086412 | EGI91559.1 (Genbank) | URP |
| Shigella boydii 5216-82 Taxon ID: 766141 | 332086227 | EGI91385.1 (Genbank) | URP |
| Shigella dysenteriae 1012 Taxon ID: 358708 | 194417257 | EDX33366.1 (Genbank) | URP |
| obsolete GIs = 417674102, 194434478, 420349152, 417691491 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | I6D3D3 | I6D3D3_SHIBO (TrEMBL) | |
| n/a | F3VAQ8 | F3VAQ8_SHIDY (TrEMBL) | |
| n/a | A0A1S9KH81 | A0A1S9KH81_SHIDY (TrEMBL) | |
| n/a | B3X539 | B3X539_9ENTR (TrEMBL) | |
| n/a | F3WN45 | F3WN45_9ENTR (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 188 | Length of Functional Domain: 163
MSKAGASLATCYGPVSADVIAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSNLLEKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



