Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.1: Phosphoserine Phosphatase Like
⌊ Family phosphoserine phosphatase
⌊ FunctionalDomain phosphoserine phosphatase (ID 31463)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Feb. 13, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Methanocaldococcus jannaschii Taxon ID: 2190 | 21730683 | ||
| Methanocaldococcus jannaschii Taxon ID: 2190 | 21730682 | ||
| Methanocaldococcus jannaschii Taxon ID: 2190 | 21730681 | ||
| Methanocaldococcus jannaschii Taxon ID: 2190 | 21730680 | ||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Phosphoserine phosphatase | Q58989 | SERB_METJA (Swiss-Prot) |
Length of Enzyme (full-length): 211 | Length of Functional Domain: 209
XEKKKKLILFNFDSTLVNNETIDEIAREAGVEEEVKKITKEAXEGKLNFEQSLRKRVSLL
KDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFA
NRLIVKDGKLTGDVEGEVLKENAKGEILEKIAKIEGINLEDTVAVGDGANDISXFKKAGL
KIAFCAKPILKEKADICIEKRDLREILKYIK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



