Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C2.A: Pyridoxal Phosphate Phosphatase Like
⌊ FunctionalDomain C2.A: Pyridoxal Phosphate Phosphatase Like (ID 304707)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Pan troglodytes Taxon ID: 9598 | 332859731 | XP_003317269.1 (RefSeq) | PRP URP |
| Pan troglodytes Taxon ID: 9598 | 410294544 | JAA25872.1 (Genbank) | PRP URP |
| Pan troglodytes Taxon ID: 9598 | 410247628 | JAA11781.1 (Genbank) | PRP URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | H2QLM4 | H2QLM4_PANTR (TrEMBL) |
Length of Enzyme (full-length): 296 | Length of Functional Domain: 278
MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNN
SRRARPELALRFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLCA
ELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDP
WHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDPARTLMVGDRL
ETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVPHYYVESIADLTEGLED
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



