Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family D-arabinonate dehydratase
⌊ FunctionalDomain D-arabinonate dehydratase (ID 295)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | CFM PubMed:16849334 |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Sulfolobus solfataricus Taxon ID: 2287 | 497675762 | WP_009989946.1 (RefSeq) | URP |
| Sulfolobus solfataricus Taxon ID: 2287 | 800906464 | AKA78645.1 (Genbank) | URP |
| Sulfolobus solfataricus Taxon ID: 2287 | 800903770 | AKA75952.1 (Genbank) | URP |
| Sulfolobus solfataricus Taxon ID: 2287 | 800901070 | AKA73253.1 (Genbank) | URP |
| Sulfolobus solfataricus 98/2 Taxon ID: 555311 | 261601507 | ACX91110.1 (Genbank) | URP |
| Sulfolobus solfataricus P2 Taxon ID: 273057 | 13816545 | AAK43225.1 (Genbank) | PRP URP |
| Sulfolobus solfataricus P2 Taxon ID: 273057 | 74538028 | PRP URP | |
| obsolete GIs = 284174086, 15899830, 384433353 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Arabinonate dehydratase | Q97U96 | ARAD_SULSO (Swiss-Prot) | |
| n/a | A0A0E3KBR6 | A0A0E3KBR6_SULSF (TrEMBL) | |
| n/a | D0KQU1 | D0KQU1_SULS9 (TrEMBL) |
Length of Enzyme (full-length): 373 | Length of Functional Domain: 373
MIKDIRTYKLCYEGINDERDALAIKGLAEHPMEIVATEIETSDGYVGYGESLAYGCSDAV
QVTIEKILKPLLLKEDEELIEYLWDKMYKATLRFGRRGIAIAGISGVDTALWDIMGKKAK
KPIYKLLGGSKRKVRAYITGGYYSEKKDLEKLRDEEAYYVKMGFKGIKVKIGAKSMEEDI
ERLKAIREVVGEDVKIAVDANNVYTFEEALEMGRRLEKLGIWFFEEPIQTDYLDLSARLA
EELEVPIAGYETAYTRWEFYEIMRKRAVDIVQTDVMWTGGISEMMKIGNMAKVMGYPLIP
HYSAGGISLIGNLHVAAALNSPWIEMHLRKNDLRDKIFKESIEIDNGHLVVPDRPGLGYT
IRDGVFEEYKCKS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.







