Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup F420, menaquinone cofactor biosynthesis

  ⌊ 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase

     ⌊ Family 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase (CofG-like)

  ⌊ FunctionalDomain FO synthase subunit 1 (ID 280297)

Superfamily Assignment Evidence Code(s) ISS PubMed:14593448 PubMed:25781338
Family Assignment Evidence Code CFM PubMed:14593448 PubMed:25781338
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Methanocaldococcus jannaschii DSM 2661 Taxon ID: 243232 15668622 NP_247420.1 (RefSeq) PRP URP
Methanocaldococcus jannaschii Taxon ID: 2190 499172358 WP_010869945.1 (RefSeq)
Methanocaldococcus jannaschii DSM 2661 Taxon ID: 243232 1591150 AAB98436.1 (Genbank) PRP URP

Uniprot

Protein NameAccessionEC Number Identifier
FO synthase subunit 1 Q57888 2.5.1.77 COFG_METJA (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 361 | Length of Functional Domain: 331

1       10        20        30        40        50        60

MDRMISREEAINFLNSTSSKDILDKLAQINNTFKREYITYSKNVFIPLSKWCRNKCGYCI
FREDKPSLMKPNEVKEILLKGDRLGCREALFTFGEHVDENKEIKEQLKSMGYDNILEYLY
DLEEWTLNNTSLLPHTNCGILNYDELKMLKDVNASMGLMLENASERLMNTIAHKHSPGKH
PKLRIEMIENAGKLKIPFTTGLLIGIGETNEEIVDSLFKIKEIHEKYGHIQEVIIQNFRA
KKGIPMENFKEPSPIKMLKVIILAKLILDDISIQIPPNLNRETGQLFLLAGVDDWGGVSP
LTRDYVNPEAEWPEIKELREWTEELGLKLKMRLPVYDKYISEEWLSEKVYNKIIEMGWLK
E
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
52 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
56 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
59 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
52 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
56 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
59 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 3/3 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
52 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:25781338
56 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:25781338
59 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IMP PubMed:25781338

Catalyzed Reaction

CofG

+ + +
5-amino-5-(4-hydroxybenzyl)-6-((2,3,4,5-tetrahydroxypentyl)amino)dihydropyrimidine-2,4-dione(1+)
85512		 S-adenosyl-L-methionine zwitterion
59789		 7,8-didemethyl-8-hydroxy-5-deazariboflavin(1-)
59904		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844

EC: 5.-.-.- | IntEnz: 5.-.-.- | Kegg: 5.-.-.- | BioCyc: 5.-.-.- | BRENDA: 5.-.-.- |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3:01 a.m. update curation agent holliday setDomainBoundaries.py
update domain start position 1 31
July 15, 2014, 4:53 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code CFM,ISS CFM
Oct. 16, 2014, 3:54 a.m. update curation agent holliday setDomainBoundaries.py
Dec. 17, 2015, 4:08 a.m. update curation agent setDomainBoundaries.py holliday
Jan. 18, 2016, 3:56 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 3:52 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update subgroup F420, menaquinone cofactor biosynthesis 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase
EC number assigned by UniProtKB accession ID.