Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup methyltransferase (Class D)

     ⌊ Family 7,8-dihydro-6-hydroxymethylpterin dimethylase

  ⌊ FunctionalDomain 7,8-dihydro-6-hydroxymethylpterin dimethylase (MJ0619) (ID 280163)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:25002541
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Methanocaldococcus jannaschii DSM 2661 Taxon ID: 243232 15668800 NP_247603.1 (RefSeq) PRP URP
Methanocaldococcus jannaschii Taxon ID: 2190 499172537 WP_010870124.1 (RefSeq)
Methanocaldococcus jannaschii DSM 2661 Taxon ID: 243232 1591330 AAB98614.1 (Genbank) PRP URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
7,8-dihydro-6-hydroxymethylpterin dimethyltransferase {ECO:0000305|PubMed:25002541} Q58036 HMPTM_METJA (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 506 | Length of Functional Domain: 503

1       10        20        30        40        50        60

MEKKTLSLCPICLKRIPATILEEDGKIIIKKTCPEHGEFKDIYWGDAELYKKFDKYEFIG
KIEVTNTKVKNGCPYDCGLCPNHKSTTILANIDVTNRCNLNCPICFANANKSGKVYEPSF
EDIKRMMENLRKEIPPTPAIQFAGGEPTVRSDLPELIKLARDMGFLHVQLATNGIKLKNI
NYLKKLKEAGLSTIYLQFDGISEKPYLVARGKNLLPIKQKVIENCKKVGFDSVVLVPTLV
RGVNDNEVGGIIRYAAENVDVVRGINFQPVSFTGRVDEKTLLEGRITIPDFIKLVEEQTD
GEITEEDFYPVPSVAPISVLVEKLTNDRKPTLSSHQHCGTSTYVFVDEDGKLIPITRFID
VEGFLEIVKEKIEEIGKSKMHDVKVLGEIALKLPSLIDLDKAPKSVNIKKIIDLILSVLK
SDYSALAELHYHMLMISCMHFMDAYNFDVKRVMRCCIHYATPDDRIIPFCTYNTLHRQEV
EEKFSIPLEEWKRMHKIGGEDDREDY
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
98 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
105 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
98 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
105 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
73 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25002541
77 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster
Notes: Mutagenesis of this residue did not eliminate the C-7 product, so it is proposed that this is the [4Fe-4S] cluster responsible for the C-7 methylation. 		cofactor binding -- binding IME PubMed:25002541
80 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25002541
98 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25002541
102 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster
Notes: Mutation of this residue in MJ0619 eliminated all C-7 methylated product. Thus, it is suggested that this is only responsible for the C-9 methylation. 		cofactor binding -- binding IME PubMed:25002541
105 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS PubMed:25002541

Catalyzed Reaction

7,8-dihydro-6-hydroxymethylpterin dimethyltransferase

+ 2 + 2 + 4 + 2 + + 2 + 4
2-amino-6-(hydroxymethyl)-7,8-dihydropteridin-4-one
44841		 S-adenosyl-L-methioninate
67040		 (6R)-5,10-methenyltetrahydrofolic acid
15638		 NADPH(4-)
57783		 6-hydroxyethyl-7-methylpterin
132441		 L-methionine zwitterion
57844		 5'-deoxyadenosine
17319		 5,6,7,8-tetrahydrofolic acid
20506		 NADP(3-)
58349

EC: | IntEnz: | Kegg: | BioCyc: | BRENDA: |

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 506 505
July 15, 2014, 3:58 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code IEA CFM
update name Uncharacterized protein MJ0619 7,8-dihydro-6-hydroxymethylpterin dimethylase (MJ0619)
Oct. 16, 2014, 3:53 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 3:52 a.m. update domain end position 505 503
EC number assigned by UniProtKB accession ID.