Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup methylthiotransferase
⌊ Family threonylcarbamoyladenosine tRNA methylthiotransferase
⌊ FunctionalDomain threonylcarbamoyladenosine tRNA methylthiotransferase (MtaB) (ID 280072)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | CFM PubMed:20584901 PubMed:20472640 |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Bacillus subtilis subsp. subtilis str. 168 Taxon ID: 224308 | 16079597 | NP_390421.1 (RefSeq) | PRP URP |
| Taxon ID: 1386 | 489322700 | WP_003230017.1 (RefSeq) | |
| Bacillus subtilis Taxon ID: 1423 | 857326059 | KMN93953.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 846137111 | AKN14558.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 825065069 | AKI92793.1 (Genbank) | URP |
| Bacillus sp. LM 4-2 Taxon ID: 1628753 | 811156681 | AKE24299.1 (Genbank) | URP |
| Bacillus subtilis HJ5 Taxon ID: 1453990 | 808340921 | AKD35779.1 (Genbank) | URP |
| Bacillus subtilis KCTC 1028 Taxon ID: 1136873 | 807074913 | AKC48119.1 (Genbank) | URP |
| Bacillus sp. CCMA 1185 Taxon ID: 1385719 | 806467106 | KKB91787.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 758318599 | KIU11723.1 (Genbank) | URP |
| Bacillus sp. YP1 Taxon ID: 1574141 | 758181070 | AJO58949.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 752645975 | KIO59796.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751906573 | KIN58007.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751901771 | KIN53319.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751895704 | KIN47341.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751891220 | KIN42962.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751887951 | KIN39753.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751881332 | KIN33261.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 751877633 | KIN29653.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis Taxon ID: 135461 | 751136827 | KIL34096.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis Taxon ID: 135461 | 749186533 | AJE95243.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 728889778 | AIY98172.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. 168 Taxon ID: 224308 | 728885468 | AIY93863.1 (Genbank) | PRP URP |
| Bacillus subtilis subsp. subtilis Taxon ID: 135461 | 672777233 | KFH36805.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis Taxon ID: 135461 | 672776037 | KFH35610.1 (Genbank) | URP |
| Bacillus subtilis Taxon ID: 1423 | 668754854 | KFC30763.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. OH 131.1 Taxon ID: 1404258 | 655531488 | AIC98929.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. AG1839 Taxon ID: 1221328 | 649016308 | AIC45230.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 Taxon ID: 1232554 | 649011944 | AIC40998.1 (Genbank) | URP |
| Bacillus subtilis QH-1 Taxon ID: 1437006 | 588501501 | EXF53912.1 (Genbank) | URP |
| Bacillus subtilis PY79 Taxon ID: 1415167 | 558569023 | AHA78429.1 (Genbank) | URP |
| Bacillus sp. EGD-AK10 Taxon ID: 1386080 | 542116654 | ERI44459.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. BAB-1 Taxon ID: 1302650 | 472255165 | AGI29696.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis 6051-HGW Taxon ID: 1147161 | 459390357 | AGG61943.1 (Genbank) | URP |
| Bacillus subtilis MB73/2 Taxon ID: 1267547 | 452115547 | EME05943.1 (Genbank) | URP |
| Bacillus subtilis XF-1 Taxon ID: 1233100 | 449028952 | AGE64191.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. BSP1 Taxon ID: 1192196 | 430023219 | AGA23825.1 (Genbank) | URP |
| Bacillus subtilis subsp. subtilis str. SC-8 Taxon ID: 1089443 | 351471143 | EHA31264.1 (Genbank) | URP |
| Bacillus sp. Taxon ID: 1409 | 724428267 | URP | |
| Bacillus subtilis Taxon ID: 1423 | 723799072 | URP | |
| Bacillus subtilis Miyagi-4 Taxon ID: 1227747 | 675438565 | URP | |
| Bacillus subtilis BEST7003 Taxon ID: 1204342 | 407965364 | URP | |
| Bacillus subtilis BEST7613 Taxon ID: 1204343 | 407959789 | URP | |
| Bacillus subtilis subsp. natto BEST195 Taxon ID: 645657 | 291484990 | URP | |
| Bacillus subtilis subsp. subtilis str. 168 Taxon ID: 224308 | 2634989 | PRP URP | |
| Bacillus subtilis Taxon ID: 1423 | 1890061 | URP | |
| Bacillus subtilis subsp. subtilis str. 168 Taxon ID: 224308 | 1730990 | PRP URP | |
| Bacillus subtilis Taxon ID: 1423 | 1303812 | URP | |
| obsolete GIs = 433621031, 452915199, 418032280, 221323991, 221319714, 221314791, 221310468, 560129497, 472330928, 470162751, 449095037, 430758699, 428280033, 816205637 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB | P54462 | MTAB_BACSU (Swiss-Prot) |
Length of Enzyme (full-length): 451 | Length of Functional Domain: 447
MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVINTCTVTNTGDKKSRQV
IRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREKMLGYIDQYREERQPIN
GVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIPWARGLLRSRDPEEVIKQ
AQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRVEGVKRIRISSIEASQITD
EVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFADRLNKLKKALPGLAVTSDV
IVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPAARMEDQVDENVKNERVHRLI
ALSDQLAKEYASQYENEVLEIIPEEAFKETEEENMFVGYTDNYMKVVFKGTEDMIGKIVK
VKILKAGYPYNEGQFVRVVEDEITEHMRLSS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.











