Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup methylthiotransferase

     ⌊ Family threonylcarbamoyladenosine tRNA methylthiotransferase

  ⌊ FunctionalDomain threonylcarbamoyladenosine tRNA methylthiotransferase (MtaB) (ID 280072)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code CFM PubMed:20584901 PubMed:20472640
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Bacillus subtilis subsp. subtilis str. 168 Taxon ID: 224308 16079597 NP_390421.1 (RefSeq) PRP URP
Taxon ID: 1386 489322700 WP_003230017.1 (RefSeq)
Bacillus subtilis Taxon ID: 1423 857326059 KMN93953.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB P54462 MTAB_BACSU (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 451 | Length of Functional Domain: 447

1       10        20        30        40        50        60

MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVINTCTVTNTGDKKSRQV
IRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREKMLGYIDQYREERQPIN
GVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIPWARGLLRSRDPEEVIKQ
AQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRVEGVKRIRISSIEASQITD
EVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFADRLNKLKKALPGLAVTSDV
IVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPAARMEDQVDENVKNERVHRLI
ALSDQLAKEYASQYENEVLEIIPEEAFKETEEENMFVGYTDNYMKVVFKGTEDMIGKIVK
VKILKAGYPYNEGQFVRVVEDEITEHMRLSS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
153 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
157 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 3/3 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
153 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
157 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding IEA
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
11 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
47 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
78 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
153 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
157 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
160 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS

Catalyzed Reaction

tRNA (N6-L-threonylcarbamoyladenosine37-C2)-methylthiotransferase

+ 2 + + + +
N(6)-L-threonylcarbamoyladenine 5'-monophosphate(2-) residue
74418		 S-adenosyl-L-methionine zwitterion
59789		 Sulfur donor
80867		 2-thio-N(6)-L-threonylcarbamoyladenine 5'-monophosphate(2-) residue
74419		 5'-deoxyadenosine
17319		 L-methionine zwitterion
57844		 S-adenosyl-L-homocysteine zwitterion
57856

EC: 2.8.4.5 | IntEnz: 2.8.4.5 | Kegg: 2.8.4.5 | BioCyc: 2.8.4.5 | BRENDA: 2.8.4.5

Curation History
Time Change Annotation Old Value New Value
May 14, 2014, 3 a.m. update curation agent holliday setDomainBoundaries.py
update domain end position 451 447
May 11, 2015, 8:44 a.m. update curation agent setDomainBoundaries.py holliday
update family assignment evidence code CFM,IES CFM
update name Threonylcarbamoyladenosine tRNA methylthiotransferase threonylcarbamoyladenosine tRNA methylthiotransferase (MtaB)
May 11, 2015, 8:44 a.m. update curation agent holliday setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.