Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.2: Nucleotidase Like
⌊ C1.2.2
⌊ FunctionalDomain C1.2.2 (ID 277145)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 1279 | 487750793 | WP_001832599.1 (RefSeq) | |
| Staphylococcus epidermidis Taxon ID: 1282 | 760489468 | AJP24135.1 (Genbank) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 721492278 | KGY35836.1 (Genbank) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 694232686 | KGJ23836.1 (Genbank) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 691219103 | AIR82390.1 (Genbank) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 653229307 | KEA32696.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU013 Taxon ID: 904315 | 645305119 | KDP69319.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU111 Taxon ID: 904331 | 645303692 | KDP68049.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU036 Taxon ID: 904318 | 645301633 | KDP66154.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU050 Taxon ID: 904322 | 610817603 | EZI14858.1 (Genbank) | URP |
| Staphylococcus aureus M0026 Taxon ID: 1388003 | 579149701 | EUR97784.1 (Genbank) | URP |
| human gut metagenome Taxon ID: 408170 | 566275362 | ETJ19870.1 (Genbank) | |
| Staphylococcus epidermidis Scl25 Taxon ID: 1344992 | 558749362 | EST98204.1 (Genbank) | URP |
| Staphylococcus epidermidis Scl31 Taxon ID: 1344991 | 558747448 | EST94255.1 (Genbank) | URP |
| Staphylococcus epidermidis E13A Taxon ID: 1115805 | 529038748 | EPZ40029.1 (Genbank) | URP |
| Staphylococcus epidermidis 36-1 Taxon ID: 1248411 | 498674471 | EON85761.1 (Genbank) | URP |
| Staphylococcus epidermidis 528m Taxon ID: 1294272 | 498670851 | EON83397.1 (Genbank) | URP |
| Staphylococcus epidermidis 41tr Taxon ID: 1294271 | 498669293 | EON81902.1 (Genbank) | URP |
| Staphylococcus epidermidis M0881 Taxon ID: 1213731 | 477939929 | ENL53411.1 (Genbank) | URP |
| Staphylococcus epidermidis AU12-03 Taxon ID: 1220510 | 406656729 | EKC83130.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH051475 Taxon ID: 1155130 | 394304642 | EJE48038.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH051668 Taxon ID: 1155131 | 394302874 | EJE46308.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH04003 Taxon ID: 1155132 | 394299634 | EJE43169.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH05003 Taxon ID: 1155133 | 394298247 | EJE41824.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH06004 Taxon ID: 1155134 | 394293849 | EJE37551.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH08001 Taxon ID: 1155135 | 394289420 | EJE33304.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH04008 Taxon ID: 979222 | 394288857 | EJE32757.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM003 Taxon ID: 979218 | 394282128 | EJE26340.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM001 Taxon ID: 979219 | 394279865 | EJE24162.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM020 Taxon ID: 979213 | 394265326 | EJE09983.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM021 Taxon ID: 979212 | 394263271 | EJE08010.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM039 Taxon ID: 979209 | 394255600 | EJE00549.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM049 Taxon ID: 979207 | 394249992 | EJD95194.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM067 Taxon ID: 979203 | 394243523 | EJD88885.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM070 Taxon ID: 979202 | 394238093 | EJD83577.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM088 Taxon ID: 979200 | 394233140 | EJD78750.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus IS-K Taxon ID: 904791 | 383362099 | EID39456.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU126 Taxon ID: 904342 | 374835172 | EHR98795.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU127 Taxon ID: 904343 | 374833184 | EHR96879.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU125 Taxon ID: 904341 | 374827261 | EHR91125.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU123 Taxon ID: 904340 | 374826333 | EHR90232.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU117 Taxon ID: 904335 | 374824077 | EHR88059.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU120 Taxon ID: 904337 | 374816063 | EHR80278.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU041 Taxon ID: 904320 | 374404788 | EHQ75753.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU109 Taxon ID: 904330 | 341653236 | EGS77007.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU105 Taxon ID: 904328 | 341652263 | EGS76052.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU045 Taxon ID: 904321 | 329738001 | EGG74225.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU144 Taxon ID: 904347 | 329723249 | EGG59779.1 (Genbank) | URP |
| Staphylococcus epidermidis M23864:W2(grey) Taxon ID: 525375 | 291317607 | EFE58024.1 (Genbank) | URP |
| Staphylococcus epidermidis SK135 Taxon ID: 596317 | 281295723 | EFA88246.1 (Genbank) | URP |
| Staphylococcus epidermidis BCM-HMP0060 Taxon ID: 525374 | 251806327 | EES58984.1 (Genbank) | URP |
| Staphylococcus epidermidis RP62A Taxon ID: 176279 | 57636981 | AAW53769.1 (Genbank) | URP |
| n/a | 47250450 | AAT20393.1 (Genbank) | |
| Staphylococcus epidermidis PM221 Taxon ID: 1449752 | 672710705 | URP | |
| Staphylococcus epidermidis RP62A Taxon ID: 176279 | 81167682 | URP | |
| obsolete GIs = 421607678, 420233949, 420231308, 420228951, 420226631, 420225294, 420222368, 420219599, 420212431, 420208254, 420197740, 420195476, 420187958, 420182447, 420172052, 420171447, 420166767, 419771128, 418629653, 418625655, 418624564, 418622577, 418618340, 418611182, 418604475, 417914152, 417911752, 417658374, 417647636, 293368184, 282875696, 251810156, 519821884, 519811316, 57866323 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Putative 5'(3')-deoxyribonucleotidase | Q5HR07 | 3.1.3.- | 53DR_STAEQ (Swiss-Prot) |
Length of Enzyme (full-length): 179 | Length of Functional Domain: 179
MTRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLKHMIPEHEGLVMDILKE
PGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAMDVPTSFHDKYEWLLEYFPFLDPQHFVF
CGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVNEHRFERVSGWRDVKNYFNSIEK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



