Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.2: Nucleotidase Like
⌊ C1.2.2
⌊ FunctionalDomain C1.2.2 (ID 276304)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Staphylococcus epidermidis Taxon ID: 1282 | 488376530 | WP_002445915.1 (RefSeq) | URP |
Staphylococcus epidermidis UC7032 Taxon ID: 1327991 | 658173196 | KEI47853.1 (Genbank) | URP |
Staphylococcus epidermidis Scl19 Taxon ID: 1344994 | 560201784 | ESV48245.1 (Genbank) | URP |
Staphylococcus epidermidis MC19 Taxon ID: 1344996 | 560197930 | ESV42347.1 (Genbank) | URP |
Staphylococcus epidermidis MC16 Taxon ID: 1344997 | 560196703 | ESV38840.1 (Genbank) | URP |
Staphylococcus epidermidis APO27 Taxon ID: 1345000 | 559811520 | ESV29646.1 (Genbank) | URP |
Staphylococcus epidermidis CIM40 Taxon ID: 1344998 | 559809093 | ESV24988.1 (Genbank) | URP |
Staphylococcus epidermidis WI09 Taxon ID: 1344987 | 559804980 | ESV19022.1 (Genbank) | URP |
Staphylococcus epidermidis WI05 Taxon ID: 1344988 | 559804066 | ESV15619.1 (Genbank) | URP |
Staphylococcus epidermidis MC28 Taxon ID: 1344995 | 559800927 | ESV10273.1 (Genbank) | URP |
Staphylococcus epidermidis CIM37 Taxon ID: 1344990 | 558753988 | ESU04732.1 (Genbank) | URP |
Staphylococcus epidermidis APO35 Taxon ID: 1344999 | 557401621 | ESR21896.1 (Genbank) | URP |
Staphylococcus epidermidis CIM28 Taxon ID: 1344989 | 557383121 | ESR04400.1 (Genbank) | URP |
Staphylococcus epidermidis Scl22 Taxon ID: 1344993 | 519838939 | EPP68548.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM015 Taxon ID: 979216 | 394274310 | EJE18731.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM031 Taxon ID: 979214 | 394271520 | EJE16013.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM037 Taxon ID: 979210 | 394261337 | EJE06136.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM023 Taxon ID: 979211 | 394260211 | EJE05026.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM057 Taxon ID: 979205 | 394252281 | EJD97319.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM053 Taxon ID: 979206 | 394251944 | EJD97005.1 (Genbank) | URP |
Staphylococcus epidermidis NIHLM061 Taxon ID: 979204 | 394243384 | EJD88750.1 (Genbank) | URP |
Staphylococcus epidermidis VCU129 Taxon ID: 904345 | 374838648 | EHS02186.1 (Genbank) | URP |
Staphylococcus epidermidis 14.1.R1.SE Taxon ID: 1000590 | 365229802 | EHM70930.1 (Genbank) | URP |
Staphylococcus epidermidis FRI909 Taxon ID: 764544 | 319401198 | EFV89413.1 (Genbank) | URP |
Staphylococcus epidermidis W23144 Taxon ID: 525376 | 242234458 | EES36770.1 (Genbank) | URP |
obsolete GIs = 420203728, 420199770, 420193088, 420189588, 420179935, 420176715, 420175449, 418633701, 418329679, 416124916, 242242093, 519824877, 519809994, 519836459, 519852613, 519851030, 519832783, 519828260, 519825750, 519819799, 519815799, 519802623 | |||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | A0A0E2NBB7 | A0A0E2NBB7_STAEP (TrEMBL) | |
n/a | A0A0E1VEC5 | A0A0E1VEC5_STAEP (TrEMBL) | |
n/a | A0A1J4HBC3 | A0A1J4HBC3_9STAP (TrEMBL) |
Length of Enzyme (full-length): 179 | Length of Functional Domain: 179
MTRERIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLKHMIPEHEGLVMDILKE
PGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAMDVPTSFHDKYEWLLEFFPFLDPQHFVF
CGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVNEHRFERVSGWRDVKNYFNSIEK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.