Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.2: Nucleotidase Like
⌊ C1.2.2
⌊ FunctionalDomain C1.2.2 (ID 270478)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus epidermidis ATCC 12228 Taxon ID: 176280 | 27467423 | NP_764060.1 (RefSeq) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 488399484 | WP_002468869.1 (RefSeq) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 653233859 | KEA37107.1 (Genbank) | URP |
| Staphylococcus epidermidis Taxon ID: 1282 | 653233062 | KEA36331.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU014 Taxon ID: 904316 | 610816285 | EZI13589.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH05001 Taxon ID: 979221 | 394289331 | EJE33216.1 (Genbank) | URP |
| Staphylococcus epidermidis NIH05005 Taxon ID: 979220 | 394285201 | EJE29285.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM008 Taxon ID: 979217 | 394276949 | EJE21282.1 (Genbank) | URP |
| Staphylococcus epidermidis NIHLM018 Taxon ID: 979215 | 394273185 | EJE17620.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU065 Taxon ID: 904324 | 374409955 | EHQ80724.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU081 Taxon ID: 904326 | 374407949 | EHQ78793.1 (Genbank) | URP |
| Staphylococcus epidermidis VCU028 Taxon ID: 904317 | 329736767 | EGG73032.1 (Genbank) | URP |
| Staphylococcus epidermidis ATCC 12228 Taxon ID: 176280 | 27314966 | AAO04102.1 (Genbank) | URP |
| Staphylococcus epidermidis ATCC 12228 Taxon ID: 176280 | 38257587 | URP | |
| obsolete GIs = 420217327, 420213625, 420206846, 420201279, 418665832, 418608776, 417656316 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Putative 5'(3')-deoxyribonucleotidase | Q8CTG7 | 3.1.3.- | 53DR_STAES (Swiss-Prot) |
Length of Enzyme (full-length): 179 | Length of Functional Domain: 179
MTRQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLKHMIPEHEGLVMDILKE
PGFFRNLDVMPHAQEVVKQLNEHYDIYIATAAMDVPTSFHDKYEWLLEYFPFLDPQHFVF
CGRKNIILADYLIDDNPKQLEIFEGKSIMFTASHNVYEHRFERVSGWRDVKNYFNSIEK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



