Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Grx2-like
⌊ FunctionalDomain cytGST-like protein (ID 235150)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 486165642 | WP_001529084.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Javiana str. PRS_2010_0720 Taxon ID: 945541 | 554258669 | ESG95009.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992 Taxon ID: 1267753 | 451909677 | AGF81483.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Javiana str. ATCC BAA-1593 Taxon ID: 891420 | 444811309 | ELX38937.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 Taxon ID: 454167 | 204320161 | EDZ05365.1 (Genbank) | URP |
| obsolete GIs = 204930702, 452120673 | |||
| Show All | |||
Length of Enzyme (full-length): 215 | Length of Functional Domain: 204
MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLP
ESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQ
YFIRKKEASSGSFDNHLAHSAELIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLR
NLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



