Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.6

  ⌊ FunctionalDomain Cytosolic GST-like protein (ID 234083)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Saccharomyces cerevisiae P283 Taxon ID: 1177187 584475374 EWH17130.1 (Genbank) URP
Saccharomyces cerevisiae CEN.PK113-7D Taxon ID: 889517 392297891 EIW08990.1 (Genbank) URP
Saccharomyces cerevisiae AWRI796 Taxon ID: 764097 323332580 EGA73987.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A7A0K1 A7A0K1_YEAS7 (TrEMBL)
n/a E7KF97 E7KF97_YEASA (TrEMBL)
n/a E7Q6M2 E7Q6M2_YEASB (TrEMBL)
Show All

Sequence

Length of Enzyme (full-length): 219 | Length of Functional Domain: 206

1       10        20        30        40        50        60

MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPV
LELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHH
ATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIF
AAIVKLQVPEECEALRAWYKRMQQRPSVKKLLEIRSKSS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3ERF Crystal Structure Of Gtt2 From Saccharomyces Cerevisiae Glutathione S-Transferase 2 4 2.23 CSA • PDB • PDBSum
3ERG Crystal Structure Of Gtt2 From Saccharomyces Cerevisiae In Complex With Glutathione Sulfnate Glutathione S-Transferase 2 4 2.2 Glutathione Sulfonic Acid CSA • PDB • PDBSum
3IBH Crystal Structure Of Saccharomyces Cerevisiae Gtt2 In Complex With Glutathione Saccharomyces Cerevisiae Gtt2 4 2.1 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:29 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 205 210
EC number assigned by UniProtKB accession ID.