Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.23
⌊ FunctionalDomain cytGST-like protein (ID 233404)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Feb. 14, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Ralstonia solanacearum Taxon ID: 305 | 489357670 | WP_003264668.1 (RefSeq) | URP |
| Ralstonia solanacearum Taxon ID: 305 | 684090134 | KFZ95207.1 (Genbank) | URP |
| Ralstonia solanacearum Taxon ID: 305 | 682149521 | KFX83003.1 (Genbank) | URP |
| Ralstonia solanacearum Taxon ID: 305 | 682142654 | KFX77545.1 (Genbank) | URP |
| Ralstonia solanacearum Taxon ID: 305 | 658126300 | KEI34302.1 (Genbank) | URP |
| Ralstonia solanacearum UW551 Taxon ID: 342110 | 83724735 | EAP71894.1 (Genbank) | URP |
| Ralstonia solanacearum IPO1609 Taxon ID: 564066 | 726237834 | URP | |
| obsolete GIs = 83748611, 206594528, 207743131 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A3RX76 | A3RX76_RALSL (TrEMBL) | |
| n/a | A0A1C0UKM9 | A0A1C0UKM9_RALSL (TrEMBL) |
Length of Enzyme (full-length): 318 | Length of Functional Domain: 317
MTELILHHYATSPFSEKARLILGYKDQPWKSVTVPVILPKPDVMPLTGGYRRTPFLQIGA
DIYCDTALIAQVLESIHPVPTLYPADRAAAAFAMAQWADTTLFWAAASFVGQPEGFKSLM
AGLPEDFVKAFVEDRKAMRAGGTGLRTPLPEAVATLQVFLAQLERQFATGEHIFLFGEQP
TIADFSVYHALWFIRRAAAVAGILDAHPEVVAWVHRMAGFGHAQAQPMTPAEALAIARAA
TPRALTDAGADFDARYGLPKGTRVTVAATDYAVDPVEGDLVVSTRDAVGVLREDPRVGQV
VVHFPRVGYAVRKVEPAG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



