Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.10

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to chloride channel ("CLIC") proteins (ID 232695)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Oryctolagus cuniculus Taxon ID: 9986 217418290 ACK44294.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a B7NZR9 B7NZR9_RABIT (TrEMBL)

Sequence

Length of Enzyme (full-length): 228 | Length of Functional Domain: 228

1       10        20        30        40        50        60

AGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKEL
KTDFIKIEEFLEQTLIPPRYPRLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSL
LREFKRLDDYLNTPLLDEIDPDSHEEFTVSRRLFLDGDHMTLADCSLLPKLNIIKVAAKK
YRDFDIPEEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYASVAKQSS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2R5G Structure Of Human Clic2, Crystal Form B Chloride Intracellular Channel Protein 2 25 1.86 CSA • PDB • PDBSum
2R4V Structure Of Human Clic2, Crystal Form A Chloride Intracellular Channel Protein 2 25 1.85 Glutathione CSA • PDB • PDBSum
2PER Crystal Structure Of Human Chloride Intracellular Channel Protein 2 Chloride Intracellular Channel Protein 2 25 2.0 5-Mercapto-2-Nitro-Benzoic Acid CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:27 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 203 228
update domain start position 7 1
EC number assigned by UniProtKB accession ID.