Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Grx2-like

  ⌊ Grx2-like.1

  ⌊ FunctionalDomain cytGST-like protein (ID 232180)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Salmonella enterica Taxon ID: 28901 446703542 WP_000780888.1 (RefSeq) URP
Salmonella enterica subsp. enterica serovar Virchow str. 07M3147 Taxon ID: 1249525 570346896 ETO90108.1 (Genbank) URP
Salmonella enterica subsp. enterica serovar Virchow str. ATCC 51955 Taxon ID: 984254 554049071 ESE94334.1 (Genbank) URP
Show All

Sequence

Length of Enzyme (full-length): 215 | Length of Functional Domain: 203

1       10        20        30        40        50        60

MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDNRYLP
ESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQ
YFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLR
NLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 1/1 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
9 Cys (C) side chain None -- ICS PubMed:11453697

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3IR4 1.2 Angstrom Crystal Structure Of The Glutaredoxin 2 (Grxb) From Salmonella Typhimurium In Complex With Glutathione Glutaredoxin 2 22 1.2 Selenomethionine
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.