Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.1: Phosphoserine Phosphatase Like
⌊ Family phosphoserine phosphatase
⌊ FunctionalDomain phosphoserine phosphatase (ID 2319)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
Family Assignment Evidence Code | CFM PubMed:12051918 |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Methanocaldococcus jannaschii Taxon ID: 2190 | 21730679 | ||
Methanocaldococcus jannaschii Taxon ID: 2190 | 21730678 | ||
Methanocaldococcus jannaschii Taxon ID: 2190 | 20151216 | ||
Methanocaldococcus jannaschii Taxon ID: 2190 | 20151215 | ||
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
Phosphoserine phosphatase | Q58989 | SERB_METJA (Swiss-Prot) |
Length of Enzyme (full-length): 211 | Length of Functional Domain: 209
XEKKKKLILFDFDSTLVNNETIDEIAREAGVEEEVKKITKEAXEGKLNFEQSLRKRVSLL
KDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFA
NRLIVKDGKLTGDVEGEVLKENAKGEILEKIAKIEGINLEDTVAVGDGANDISXFKKAGL
KIAFCAKPILKEKADICIEKRDLREILKYIK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.