Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Grx2-like
⌊ FunctionalDomain cytGST-like protein (ID 231451)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Salmonella enterica Taxon ID: 28901 | 446703552 | WP_000780898.1 (RefSeq) | URP |
Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 Taxon ID: 476213 | 224468858 | ACN46688.1 (Genbank) | URP |
obsolete GI = 224584331 |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | C0Q843 | C0Q843_SALPC (TrEMBL) |
Length of Enzyme (full-length): 215 | Length of Functional Domain: 203
MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDESRYLP
ESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQ
YFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLR
NLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.