Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.23

  ⌊ FunctionalDomain cytGST-like protein (ID 231013)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onFeb. 14, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Ralstonia solanacearum Taxon ID: 305 502971055 WP_013206031.1 (RefSeq) URP
Ralstonia solanacearum CFBP2957 Taxon ID: 859656 299071742 URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a D8NJ44 D8NJ44_RALSL (TrEMBL)

Sequence

Length of Enzyme (full-length): 320 | Length of Functional Domain: 319

1       10        20        30        40        50        60

MTDLILHHYATSPFSEKVRLILGYKDQPWKSVTVPVILPKLDVMPLTGGYRRTPFLQIGA
DIYCDTALIAQVLESIHPVPTLYPADRAAAAFAMAQWADTTLFWAAASFVGQPEGFKSLM
AGLPEAFVKAFVEDRKAMRAGGTGLRTPLPEAVATLQVFLAQLERQFATGEHIFLFGEQP
TIADFSVYHALWFIRRATAVAGILDAHPAAVAWMHRMAGFGHAQAQPMTPAEALDIARAA
TPRALTDTGAGADFDARYGLPKGTRVTVAATDYAVDPVEGDLVVSTRDALGVLREDPRVG
QVVVHFPRVGYAVRKVEPAG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4KF9 Crystal Structure Of A Glutathione Transferase Family Member From Ralstonia Solanacearum, Target Efi-501780, With Bound Gsh Coordinated To A Zinc Ion, Ordered Active Site Glutathione S-Transferase Protein 3 2.3 Zinc Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:53 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 219 319
update domain start position 3 1
EC number assigned by UniProtKB accession ID.