Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.18

  ⌊ FunctionalDomain cytGST-like protein (ID 230351)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onFeb. 14, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Klebsiella pneumoniae Taxon ID: 573 504720055 WP_014907157.1 (RefSeq) URP
Klebsiella pneumoniae Taxon ID: 573 839734784 KMI08022.1 (Genbank) URP
Klebsiella pneumoniae Taxon ID: 573 839731822 KMI05087.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A164BTT8 A0A164BTT8_KLEPN (TrEMBL)

Sequence

Length of Enzyme (full-length): 212 | Length of Functional Domain: 206

1       10        20        30        40        50        60

MSQPVITLWSDADFFSPYVMSVYVALQEKSLPFTLKTVDLNRGEHLQAGWTGYAATRRVP
LLEVDDFALSESSAITEYLDERFAPPEWERIYPHDLQKRARARQIQAWLRSDLMPIREER
STAVVFGGAKMPDLSEAGRQSAEKLFATATTLLAHGGQNLFGEWSIADADLALMLNRLVL
NGDKVPEALADYASFQWQRASIQRYVALSAKR
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4JBB Crystal Structure Of Glutathione S-Transferase A6Tby7(Target Efi-507184) From Klebsiella Pneumoniae Mgh 78578, Gsh Complex Putative Glutathione S-Transferase 4 1.48 Glutathione
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.