Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.6
⌊ FunctionalDomain Cytosolic GST-like protein (ID 229855)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Saccharomyces cerevisiae R103 Taxon ID: 1182967 | 584374865 | EWG94759.1 (Genbank) | URP |
Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7 Taxon ID: 1095631 | 365764242 | EHN05766.1 (Genbank) | URP |
Saccharomyces cerevisiae VL3 Taxon ID: 764100 | 323354006 | EGA85858.1 (Genbank) | URP |
Saccharomyces cerevisiae Lalvin QA23 Taxon ID: 764098 | 323347574 | EGA81841.1 (Genbank) | URP |
Saccharomyces cerevisiae Vin13 Taxon ID: 764099 | 323336517 | EGA77783.1 (Genbank) | URP |
Saccharomyces cerevisiae RM11-1a Taxon ID: 285006 | 190405995 | EDV09262.1 (Genbank) | URP |
Saccharomyces cerevisiae EC1118 Taxon ID: 643680 | 259147933 | URP | |
Show All |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | E7QHL7 | E7QHL7_YEASZ (TrEMBL) | |
n/a | C8ZCR6 | C8ZCR6_YEAS8 (TrEMBL) | |
n/a | H0GJT0 | H0GJT0_SACCK (TrEMBL) | |
n/a | E7KRB8 | E7KRB8_YEASL (TrEMBL) | |
n/a | E7LX62 | E7LX62_YEASV (TrEMBL) | |
n/a | B3LTB9 | B3LTB9_YEAS1 (TrEMBL) | |
Show All |
Length of Enzyme (full-length): 219 | Length of Functional Domain: 206
MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPV
LELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHH
ATPGLGPEVEFYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIF
AAIVKLQVPEECEALRAWYKRMQQRPSVKKLLEIRSKSS
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.