Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Omega and Tau class GSTs (ID 228968)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Glycine max Taxon ID: 3847 | 255626415 | ACU13552.1 (Genbank) | PRP URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | C6SWC9 | C6SWC9_SOYBN (TrEMBL) |
Length of Enzyme (full-length): 207 | Length of Functional Domain: 205
MRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEE
VWNDRNPLLPSDPYQRAQARFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLE
EQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVA
KSLPDQQKIYEFIMDLRKKLGIEYVGA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



