Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.9
⌊ FunctionalDomain Cytosolic GST-like protein (ID 228236)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| blood disease bacterium R229 Taxon ID: 741978 | 344169273 | ||
| Ralstonia solanacearum PSI07 Taxon ID: 859657 | 299077525 | URP | |
| obsolete GIs = 502976533, 300690465 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | G2ZRC5 | G2ZRC5_9RALS (TrEMBL) | |
| n/a | D8NYM0 | D8NYM0_RALSL (TrEMBL) | |
| n/a | A0A1U9VK48 | A0A1U9VK48_9RALS (TrEMBL) |
Length of Enzyme (full-length): 202 | Length of Functional Domain: 202
MKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGAL
FDSSVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVMLRVEQTQRTSEQRS
ESWIARQHHKIDEALKAMSRGLADKTWCNGNHLTLADIAVGCALAYLDFRQPQIDWRERH
TNLAAFYARIEKRPSFMETQPQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



