Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Grx2-like
⌊ FunctionalDomain cytGST-like protein (ID 226725)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 446703543 | WP_000780889.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum Taxon ID: 594 | 733359225 | KHK44305.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Stanleyville str. CFSAN000624 Taxon ID: 1194159 | 554474559 | ESJ92112.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. 9184 Taxon ID: 685040 | 444845874 | ELX71057.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. SG9 Taxon ID: 909947 | 326628176 | EGE34519.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 Taxon ID: 550538 | 205272877 | URP | |
| obsolete GIs = 375123926, 445135226, 205353096 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0G2NNF4 | A0A0G2NNF4_SALGL (TrEMBL) | |
| n/a | B5RBD5 | B5RBD5_SALG2 (TrEMBL) |
Length of Enzyme (full-length): 215 | Length of Functional Domain: 201
MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLP
ESIDIVHYVDNLDGKPLLTGKRNTAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQ
YFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLR
NLTLVAGIHWPIKVADYRDNMAKQTQINLLSSMAI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



