Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.22

  ⌊ FunctionalDomain cytGST-like protein (ID 226438)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Laternula elliptica Taxon ID: 228457 222107826 ACM44933.1 (Genbank)

Uniprot

Protein NameAccessionEC Number Identifier
n/a B9VX79 B9VX79_9BIVA (TrEMBL)

Sequence

Length of Enzyme (full-length): 223 | Length of Functional Domain: 220

1       10        20        30        40        50        60

MATTSKPFVYWGSGSPPCWKVLLVLQEKKIDYDEKIISFSKKEHKSEEILELNPRGQVPT
FTDGDVVVNESTAICMYLEEKYPKVPLFPSDTTIRAKVYQRMFETSNISTNVMEFVQYKM
KNKDSIDQVLLKEKKDKAHVELGHWENYLKQTGGFVATKEFTMADVFFFPMVALIVRQGA
NLKDSYPNIFKYYNMMMDRPTIVKTMPPHWAESDSPGNLLDLC
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3QAW Crystal Structure Of A Glutathione-S-Transferase From Antarctic Clam Laternula Elliptica In A Complex With Glutathione Rho-Class Glutathione S-Transferase 2 2.2 Glutathione CSA • PDB • PDBSum
3QAV Crystal Structure Of A Glutathione S-Transferase From Antarctic Clam Laternula Elliptica Rho-Class Glutathione S-Transferase 2 2.1 CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:44 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 199 222
update domain start position 8 3
EC number assigned by UniProtKB accession ID.