Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.9
⌊ FunctionalDomain Cytosolic GST-like protein (ID 226036)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank: obsolete GIs = 207721601, 421895597, 206586762, 489366494
Length of Enzyme (full-length): 202 | Length of Functional Domain: 202
MKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGAL
FDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVTLRVEQTQRTPEQRS
ESWTTRQHHKIDEALKAMSRGLADKTWCNGNHLTLADIAVGCALAYLDFRQPQVDWRERH
PNLATFYTRIEKRPSFMETQPR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.