Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ FunctionalDomain Cytosolic GST-like protein, similar to Omega and Tau class GSTs (ID 225655)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Glycine max Taxon ID: 3847 | 351721193 | NP_001237713.1 (RefSeq) | PRP URP |
| Glycine max Taxon ID: 3847 | 2920666 | AAC18566.1 (Genbank) | PRP URP |
| Glycine max Taxon ID: 3847 | 659835590 | PRP URP | |
| Glycine max Taxon ID: 3847 | 659835589 | PRP URP | |
| Glycine max Taxon ID: 3847 | 257333144 | PRP URP | |
| Glycine max Taxon ID: 3847 | 219746330 | PRP URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | O49235 | O49235_SOYBN (TrEMBL) |
Length of Enzyme (full-length): 219 | Length of Functional Domain: 219
MSDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHN
GKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEE
KEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECP
KFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



