Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.9
⌊ FunctionalDomain Cytosolic GST-like protein (ID 224732)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | March 11, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Ralstonia solanacearum Taxon ID: 305 | 523412240 | WP_020747562.1 (RefSeq) | URP |
| Ralstonia solanacearum CMR15 Taxon ID: 859655 | 299065727 | URP | |
| obsolete GI = 523408905 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | D8N6U1 | D8N6U1_RALSL (TrEMBL) |
Length of Enzyme (full-length): 202 | Length of Functional Domain: 202
MKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGAL
FDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRS
ESWIDRQHHKIDEALKAMSRGLADKTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQH
ANLAAFYTRIEKRPSFLETQPQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



