Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.9

  ⌊ FunctionalDomain Cytosolic GST-like protein (ID 224732)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Ralstonia solanacearum Taxon ID: 305 523412240 WP_020747562.1 (RefSeq) URP
Ralstonia solanacearum CMR15 Taxon ID: 859655 299065727 URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a D8N6U1 D8N6U1_RALSL (TrEMBL)

Sequence

Length of Enzyme (full-length): 202 | Length of Functional Domain: 202

1       10        20        30        40        50        60

MKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGAL
FDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRS
ESWIDRQHHKIDEALKAMSRGLADKTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQH
ANLAAFYTRIEKRPSFLETQPQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3TOT Crystal Structure Of Glutathione Transferase (Target Efi-501058) From Ralstonia Solanacearum Gmi1000 Glutathione S-Transferase Protein 7 1.76 Acetate Ion CSA • PDB • PDBSum
3TOU Crystal Structure Of Glutathione Transferase (Target Efi-501058) From Ralstonia Solanacearum Gmi1000 With Gsh Bound Glutathione S-Transferase Protein 7 1.75 Glutathione • Acetate Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 16, 2016, 8:40 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 193 202
EC number assigned by UniProtKB accession ID.